TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q47377|ARNE_ECOLI Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE OS=Escherichia coli (strain K12) GN=arnE PE=1 SV=2
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLA
AVKLWHEPVSPRHWCGVAFIIGGIVILGSTV