TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4JEV5|Q4JEV5_WHEAT Pore-forming toxin-like protein Hfr-2 - Triticum aestivum (Wheat).

MFPVTGSPKCVAFRSKHTRKYLGSVQAGSEESAGGGKFFEELSHGADDVDVLASPYTRFYLEPSKEHDGLLHVRCCHKNK
YWVAKHVGEGSGHWIIGIVNEPEDDLSKPSCTLFEPIPLADTDNNLSIRFFRPQQTTSSESDMTKEKGTTEEAYLFLGIG
GHEKTVDQVKSLHDFSAIDLSKQLVLPKYVAFKGDNDMYLRARIIQKRNYLEFSSSDIADSTVVNTIFPNYANGNVRIKS
NHFNRFWRLSPNWIWADSADTSSRDRDTLFRVVMLPDYIGLQNLGNSRYCKRLTADKKTSCLNAAVDTITLEARLRVEEA
VLSREVYGVEFKLFEARIYGEKPLTFPSMTSTNDTNETHAKTLTLEYEETQAKTWSSTVSLKIGVTAKLRAGIPVIAEGK
VEVSTEFNSEYEWGSSIQTTTSQEASYQAVVPPMTKVTIRAAATQGSIDVPFSYTQRDILTTGEVVTYKMDDGLFTGMNN
YNFQFEATQEPI