TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4QAW6|Q4QAW6_LEIMA Glycosomal membrane like protein OS=Leishmania major GN=LMJF_24_0150 PE=4 SV=1
MSVVGTLSTYMAATDSRDKMIKGAGCFFKLMGALYGNPNFMKAGAAMSDARCLIRMLSWLSNVQKISDAMEKRIVQPRDV
LFVLRVLFDGIFSLLDNIVFAGRFFNPNSPSLSQMSYVSRASLFYGYAVAVVLDVYDLARDPKMPKRGDRYLVLTRNACD
MVSAIGNVCTVDIGGVNVAGLGLISAIIATREQLLAAATKSGGNTIGTIPAKAAAQQPKK