TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4QF51|Q4QF51_LEIMA MGT1 protein OS=Leishmania major GN=MGT1 PE=4 SV=1
MSSNASKTETPASLLAEDATMTSLDRLTNLGTSIFFTPPSVEHPSAASELGSSHAPPPPRVQDLANVVLPLASAEARVSN
VLSFARRPLEIVESIKGLHELHQKGGLTREEFAQAKQQILDSAASSASTYKSKSKRSRGRRHRRRGRRSRNSSRSASTST
RTRPSRNARSRATTGVDTRSASHRPSRSSSSSKSSSSSSSSSSNRFIIVPRSNVWRTLNDPIEGLLGHHSTEGHHVRVAY
NDAPRLVRSPLLSRGGAVVGFGSRERGGQEECCAGAHGRHGYQEIPSEDPLTSNLASGAAVPTPTLATAPGTKDGVFASP
SGSAIGAATAATGSSVARYATVPDGRGKATYGAFLHRDDDARAGGPAPHIHAVLNKEDVVCIQYFNSRGGSGNHFRDVEL
HTSQLRDPIFVHKGQSQVIPAKPRTSVAKPSRDEPVMMAMPTRDSQVFQLAEMTLEERCAWEEMTTTHSSSSKSRRAKSS
YFEQSFNWYWVDVTGRDASRQQYNAMLHYLTNRFKLCESFLVDREHTLVLPQVCESPIYAGQYLLNLRVATEKIAISDDS
VMELTNRWIVVVDLKQHIVITLHRVDTHSMANLRSQWKRVIENSNVSFQEFLLKIIDDAIYTYHLSLDVHTALLEKCEAK
LFVEKPAVTTPEVSGHYIDKQILHHFAGSSRSLFLRRLLDEQDRSPMDKGEMNSFLHHLHRRTSVQHRMINVTQAVLAKA
FTKLRLCSREMAGQMCASCIEISDRALEVRDDAKTLLNLHISLQSFRTTELMAVLTRVTMLFTPVTFLAGVYGMNFQKNF
PELTWDYGYPFFWALCIVLVIAMHVLFLRKH