TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q53185|AMIS_RHOER PUTATIVE TRANSPORTER PROTEIN AMIS2 - Rhodococcus erythropolis.
MGSVGLLYVGAVLFVNGLMLLGTVPVRSASVLNLFVGALQCVVPTVMLIQAQGDSSAVLAASGLYLFGFTYLYVGISNLA
GFEPEGIGWFSLFVACAALVYSFLSFTVSNDPVFGVIWLAWAALWTLFFLVLGLGRENLSRFTGWAAILLSQPTCTVPAF
LILTGNFHTTPAVAAGWAGALLVLLGLAKILAAPKAAVPQPRPVFN