TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q54CR4|Q54CR4_DICDI Putative uncharacterized protein OS=Dictyostelium discoideum GN=DDB_0184543 PE=4 SV=1
MLNSVGGSVATKVGASFLPESSLLKTIAKYAAWATGALLVLLGGISIFDSHWIIGPICIALGGVMLVIEFAVPFAAQFQL
FLTVFEYKIRGIMYVCFCVPAFFTVFTIAPGLGCIFSGGIYVILGFVKNEKAELPQYNKQRDVENGHMNSSDNN