TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q54LG2|Q54LG2_DICDI SAPLIP C protein OS=Dictyostelium discoideum GN=salA PE=4 SV=1
MKYLKGLILALVALSSVNSLNIKDDAECMLCNVIVDEAEAYVAQNFNSTEISSILSENCQLLPSFQDVCIGIVDEYTPTI
IKYIIAKESPTTICEQINCCDSSSSSSSSQDSSSSNNDSWSEFGSSSQDSSSFENNSSSDNSQSNTGASTGTSGHSL