TCDB is operated by the Saier Lab Bioinformatics Group
Q559K0|Q559K0_DICDI Putative uncharacterized protein - Dictyostelium discoideum (Slime mold).
MEDSDKENTLLLPNNKYRNQNFIRNQDEDENENENNDNLENDNNKRNYISINNYEPYKEIDNNNNKNNNNNNIINNNNKI
NFYNNLIPRIKSYFQEIKPFLKYCSFSFLFSFDPSEPYLVDYFTNVLGINQTIVYQEIYPYWTYSYFVFLLIFGILGEII
GYKVIIIIGMVAKILTIGVLLSTNNIIWMILEQITEGLSYSAYTVFLAYIYFSLDTSEYQKMACRVNAGYLVGIVSSGLL
GQLLVEQRLPLVYLLSIACGTNILALILALGFSNYKIDQKFSLKEVISDLFGTFKNADIVRWYIWSGIAISIHQIVITYW
QNLFLQVNDEQSWNGYISASAYFFASFFAIIPSKLGNKINNIQGIILVLFGLLGGGLLVLMGFGGSTVVSALSFIIYNCC
FEFVSPIVNVQIAKKLSSRIGVLFSFNIMVALTIQVLVQSAVGKQFLNLDIKTQFYYYGACLFFLSFGFAILFGFLFLKK
KINSNSNSNSNVDVLIVNHNTQNQNSEEKKKKKELYYNANIIDFENNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNVGIG
GNDNFK