TCDB is operated by the Saier Lab Bioinformatics Group
>Q57134|Y1008_HAEIN Uncharacterized protein HI1008 - Haemophilus influenzae.
MKTLFTSVVLCGALVVSSSFAEEKATXQTAQSVVTTQAEAQVAPAVVSDKLNINTATASEIQKSLTGIGAKKAEAIVQYR
EKHGNFXNAEQLLEVQGIGKATLEKNRDRIIF