TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q58AJ7|Q58AJ7_RALME PbrB/pbrC lead resistance fusion protein OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=pbrB/pbrC PE=3 SV=1
MSWKAIFYDWGGLNGALFQLINAATPAFLMPLAWLFSNVLGNYWTAPVVVLGLWAWSSSTAEARRTMAIRCQLLQFVVGF
GIAFAIASCLKLGLDFPRPAAVFGQLDHVLGTVEERYSLPSGHSTYAALVAGALWPLLGIRRRLALIVYVVLVGWSRIAA
GMHFPADVLAGWGIATVSLMLAGFLVRMLPGAIRTMATRASGAWYALAAAVLLGDQLAKTVISQLFGYGEQVGITPFFNL
VHVRNNGAAFSLLAGAGVWARVGFAALAMCISLWLIDQLRRGAPRWEAAGYCLILGGALGNAADRLLRGAVVDFLDFHWR
GTHWPAFNLADVAITVGAVCLIVATRRRGGQIRANSTA