TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q5BIV9|SPRN_HUMAN Shadow of prion protein OS=Homo sapiens GN=SPRN PE=2 SV=1
MNWAPATCWALLLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPGSSLRVAAAGAAAGAAAGAA
AGLAAGSGWRRAAGPGERGLEDEEDGVPGGNGTGPGIYSYRAWTSGAGPTRGPRLCLVLGGALGALGLLRP