TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5DF80|Q5DF80_SCHJA SJCHGC04441 protein OS=Schistosoma japonicum PE=2 SV=1
MLQDVLSIICISFFTAFLGEGLTWLFVYRTEKYQKLKAEVDKQSKRLEKQRDVTESAIDRAAKKRLEKQEERFKNINREL
SMVKMKSMFAVGLIFTSLFNVFSSIFDGRVVAKLPFVPFSWIQGLSHRNLPGSDFTDGSFVFVYILCTMSIRQNVQKILG
FAPSRSFNKQSTGFAQS