TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5LR30|Q5LR30_RUEPO BioY family protein OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO2302 PE=4 SV=1
MSMTVLADAIGPREGTARLAKQAVLVVLGIAALAIAAKIKVPMWPVPITMGTFAVLTLGTAYGARLGLVTMMGYLLVGAL
GFDVFATSSAEKFGLTYMMGGTGGYLVGYLMATVLLGALAARGWDRSFAKMALALVLANVLIYVPGLLWLGQLYGWDKPI
LQWGLTPFLVGDALKLVLAAVLIPGLWKLVGNARG