TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5SGW2|Q5SGW2_THET8 Competence protein ComEC OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1968 PE=4 SV=1
MRPSWTWGVGLGAGALVAAWGLFAPWAFLGLGLLPFLRLPFALGFGLVLARALLFPLPEPPWGAAVEGVFAVRGGFTRAE
GHLLWVSHYPPLPDGRYRLRGRIAPPQGRTNPGGFDQRAWLLSRGAKGVLRAESAEPLGPLPDWREGFRERLGAGLSLEA
REVVEGLVLGDKGGLETAYPLFQRAGLAHLLALSGLHVGVLVGFAVLGLYPLGRWRYLLALALLPFYLLLAGPSPSLVRA
SLMAGLSLLGLFLGLGGAGVVQALGLALFLQLLLRPEALLGLGFQLSYLAVLGLALVLPALRLPPGPRGYLLGGVAASLA
VQAFLLPLLLHRFGFAPLLAPLANLLALPLVALLVPLGFLKLFLGALPAPLVEPLARGLLLLAGLAAQGPLLRWGEIAPP
GFALYYLGLLPLLFALHRRLPWRRALLLASLPTLVGLLAARPKPLDLWMLDVGQGDALLARMGGGEVLVDGGRAEKGEAV
VRALRALGVEALELLVATHPDADHYGGLFRVIEEVPVGLALLAPGFPEDHPLAQALRARGVPVVRAGAGTRLKVGQGEVR
VLWPEALSGDDNQDGLALLLDFGRGRALLLADLPREVEARLPVGEVEALKVSHHGSQSGTSEVLLERTRPRVALIGVGPN
PFGHPHPEVLERLERHGAEVRRTDQDGAVRVLFGYAW