TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5UXT6|Q5UXT6_HALMA Protein-export membrane protein SecF OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=secF PE=3 SV=1
MYGTADVSGSDWEGLFRPVSHRSVMFEFEVPEVDYTQYSNRQLVAVPLVVLGLALAVLGGWYLVTGAPVSPSIDFTGGSE
LTVESSLSQAELRDNTFDEPVVSVQQVEGENRYIITFDSSNLEPIEETARSSDQMEFLGSGTTSPIFGQENQRLAVVGIG
VAFLGMSLLVFAMFRSVVPSIAVVLSAFSDLVIPLAVMNLLGIKLSLGTVAALLMLIGYSVDSDILLNNHVLRRSGGFYE
STYRAMRTGVTMTLTSMAAMAVMAISATIFGIELMASIGFVLVVGLAADLMNTYMLNVTLLRWYKYEGVKR