TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5WA61|Q5WA61_BOMMO Olfactory receptor-1 OS=7091 GN=BmOR-1 PE=2 SV=1
MLLSFKDDSRSPDIQKPQNFQYMKILRFNLKIICAWPEKQLNEIRSLGHSIHRVILPIQSVVCLACGILYIHFHFNEIPF
FILASTFITVMMNLVTCSRTALVMLFERYLVLTGRFITVMHLFNFQKNSDYAYKLCTFVNRMSHFYTLYVLFSMFMGLGL
FNLLPLYNNYVSGAFSDPYGPNVTFFHSVYFAFPFDYSHNFRGYIIMALFNSYVSVTCSIGLVMFDLLMCLMVMHVWGHL
KILSHNLINFPRPKASHVITTPNGPTNVETYTEEESKEVFARLRECIKHYGTVDDFANDMSETFGVILLVYYGFHQVSLC
MLLLECSDLSTKAMLRYGPLTLIMIQQLIQISIIFELLGSVADRIPDAVYQLPWECMDVKNRRVVYGFLRRTQNPVRFKA
MGMLDVGVQTMASILKTSISYFVMLRTVAT