TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5WSP6|Q5WSP6_LEGPL Putative uncharacterized protein OS=Legionella pneumophila (strain Lens) GN=lpl2831 PE=4 SV=1
MKDKTIPSPDAKSFNKKEFSENVAKGAIVGATSTTMTFGLFDKPLAIATKASSEVAQHPWRGIKSLFAGALNGSFSTSWN
NSLYAQAYRAYLEHPVKGYPVALLNSCLKNVVFFPAKYGSERALYALSGNEQQAKNYSGFLAGLMTVYLTAPISVVKARL
MTNVPLNTLSLKRLGSGVNAIAMRDCIQYGIYFNAKERLNEKIGDGVMAGGIAGIVGYVFSNPLSVIGLNQKTAVESVNI
PNMAKRIYQANGVKGFYPLVGLAAWGMFARGVAIHQGTKLYESLQEKEAYGRPTRNRE