TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5YZF5|Q5YZF5_NOCFA Putative uncharacterized protein OS=Nocardia farcinica GN=NFA_15900 PE=4 SV=1
MHRTMKIHKNTLRAAGACAAATVAFGMLSAGAANADTFVPLPGGEITKTLSDGTVVTVRLVGESATISPSMGATPVHRNA
WVSGSAQVEISGGGEDVGGKIYPGYVVGCQVNIDGGGVEGGVEGSADWSGDTVTGGVGAESGGELTLGPGQAKSFYILDI
EKPDDYGNEDHATNNKFKGNSGSVTWADSTIGLSGCAGYAQARSFVKVKVETDNVMSVVTLWGQPFSLG