TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q61168|LAM5_MOUSE LYSOSOMAL-ASSOCIATED MULTITRANSMEMBRANE PROTEIN (RETINOIC ACID- INDUCIBLE E3 PROTEIN) - Mus musculus (Mouse).
MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRMADLLSSFLLIGVLFIISISL
LFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAYLKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTY
LNFKSMNHMNYLPSQEGVPHSQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEE
ALSLPPKTPEGDPAPPPYSEV