TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q66I64|Q66I64_DANRE Aqp8a protein OS=Danio rerio GN=aqp8a.1 PE=1 SV=1
MTSAESKSELFTVATGDGGDNHQNQPKKLPFFEHYIQPCLAEVVGSFLFMFVGCVSVMGNVGISGSIQPALAHGLALAIA
IAIFGEISGGHFNPAVSVCVYLIGGMEVILLVPYIISQMLGGVIAASLAKAVTTNDAFSNATGAAFNAIPSSDGIGAATM
AEMIMTLFLTIVVSMGAVNGRTKSQLAPFCIGLTVTANILAGGGISGACMNPARAFGPAVVSGHWTHHWIYWVGPLTGAL
VTVSIVRLVMGDKKVRVIFK