TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6LNU9|Q6LNU9_PHOPR Putative bacteriocin production protein OS=Photobacterium profundum GN=SF2389 PE=4 SV=1
MMIWIDYVILGVIGFSALVSLIRGFVKEALSLVIWFAAFFIASNFYNQLAAYFTNIQDDTLRNGSAIAVLFISTLVVGAV
VNYVIGQLVQKTGLSGTDRVLGVVFGGVRGVLIVSSILFFIDTFTGFSSADWWKASELIPQFGMVIEWFFSYIKDTSSFL
PGAL