TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6LXR9|Q6LXR9_METMP Putative uncharacterized protein OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1280 PE=4 SV=1
MKQYLPVLLLVLSNIFMTFAWYGHLKYKMSPLWIVILVSWGIAFFEYCLQVPANRIGSNYFTTAQLKVIQEIITLVIFSI
FSLLYLKEEFRWNYAVGFFFIILAAVFIFKKW