TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6VS78|Q6VS78_AEDAE Nutrient amino acid transporter long isoform - Aedes aegypti (Yellowfever mosquito).
MPEIATISYPESKKNDEANSSHGNGNGVVQLNASQPENAAQNRPEWLELAESSNFLCHVFQCPLVNQLNASQPENAAQNR
PEWSNKLEFLMSCISMSVGLGNVWRFPFTAYENGGGAFLIPYLIVLFVIGRPLYYLEMALGQFTSRSSVKIWEVSPLFKG
IGIGQLVGTTSVVSYYVSLIALTLHYIFASFASELPWATCKDNWADNCVDSSLVVNEMRDSNSTSGQKVSSSQIYFLDIV
LKEKDSIDDGIGAPDWKLTLWLLLAWVVIFLVLVRGVKSSGKVAYFLAIFPYVVLIIILVRALTLEGAVDGVIFFIKPQW
GELLNPKVWYSATTQLFSSLSVGMGSIIMFSSYNNFHHNIYRDAMIVTTLDTFTSLLGGMTIFSILGNLAHNLGIEDISK
VVKSGTGLAFISYPDAIAKFDIVPQLFSVLFFFMLFVLGVGSAVALHGAIITAFWDAFPKRKYWHLALILSTIGFCTGLV
YITPGGQWILDLVDHYGGTFLIYVLAIIEMVAIFWIYGLDNWCNDIEFMVQRRVGLYWRLCWGLITPLFMIAVFIYSLVE
YKWPTYSGQQYPGEALICGIFVFIFGILQVLIWAVWTVTGHSTKESVWGKITKAAKPSSQWGPCTEHTRKAWLKYKEEAK
SRRDDIIYAKNHSSIVRKLCVLFGMYDDFIRLDSTRL