TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6WRW9|Q6WRW9_HAFAL Alveicin A immunity protein OS=Hafnia alvei GN=aai PE=4 SV=1
MTRKYYIHNMFWGYFMAACILYASYGDDEPKIIALRIFGLASAILFPFSRFLIEKAALRYTKKEFWKTGFFKDGVPKTYL
MTLYFIFIFMTSIPIGVLSVCFEIKNVTAKI