TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q72IW4|Q72IW4_THET2 Competence protein pilQ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pilQ PE=3 SV=1
MKSAWIRAAVIALAGLGAFALAGSFPEEPRFQAPVNLKVSESQVKAGQTLPLDVVLEALARSVGLQPLIYRAYDPSGDPA
TAQPPLPNVKLDFQGKPFREVWDLLFATYGNQYSLDYLFLPPDVVVVAPTQVITALVDAPSRTGAMERRPYIVGVPEIAY
KRTETDAQGQPRTVVNIEGAKAWVQNDLLPFLSREAAGLNVNWIVVEEGGRLKAVLSVLATPEQHARFSDILQRAGIDFR
PLPALAQPKPRVEKTYTLTYATFPDLLAFLQSRLPEAQIGVVPTNPQRAIVLATEEDHARLSELLKTADVPKTVRRVYTL
QNLTFAEAQERLKPLLEKDLKGARLESLPGNPKALLLEAPEAEHALFAEILKALDVPPQAPQAPQEATLRRLYPLHYANA
EQVAPFLAREVPGIVVQTVPGQPLLSVRGTEAQLREVESLLAQIDRPPEQGPPVFQRAYQLSNAKAVELAQVLQEALKAR
QAQNQGQQNQAPPTREATVVADPRTNTLIVTGTQEDLALVEGLIPKLDQPVPQVNLRVRIQEVQSNLTRSLGLKWNSIAG
GNVAASILDSGLSLIFDSTRSLAALNIMATLDALQQQGLSRALRDVNQTVLNNQTARLQSGETFFIRRVVNDQVERVPFD
VGLIVEVTPQITADGQILLNIKAEVSGNVQRNPVDGDVDRFTKQVVTTTLRVKDGETVVLGGLTSQESNQSQQGVPLLMD
IPLIGELFKQRTNESTDKELLVVITADILKEAASANP