TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q76158|Q76158_9HIV1 Env protein (Fragment) OS=Human immunodeficiency virus 1 GN=env PE=4 SV=1
VVQREKRAVGIGALFLGFLGAAGSTMGARSVTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWG