TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q79ED9|Q79ED9_ECOLX Colicin E8 immunity protein OS=Escherichia coli PE=4 SV=1
MELKKSIGDYTETEFKKFIEDIINCEGDEKKQDDNLEYFINVTEHPSGSDLIYYPEGNNDGSPEGVIKEIKEWRAANGKS
GFKQG