TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7K0L7|Q7K0L7_DROME CG6608, isoform A OS=Drosophila melanogaster GN=CG6608 PE=2 SV=1
MAVTTGSTSEATTTTTPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYT
SIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLD
VIRTRLIAQDTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTL
LGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALY
FSIYDKLKQVRF