TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7KSQ0|Q7KSQ0_DROME CG6782, isoform A OS=Drosophila melanogaster GN=CG6782 PE=2 SV=1
MDRSAFASLVSPYRRRPWMTEHGAAAADSGQVGLKGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVK
KTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFIN
DQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGA
ASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNKVWV