TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7ULG9|Q7ULG9_RHOBA Putative uncharacterized protein OS=Rhodopirellula baltica (strain SH1) GN=RB9508 PE=4 SV=1
MFFSIQEMNGSGAQTTEMEGVNCLDNEAFFERFRGTSMDQNQSAQKLHIAKVVLCAAFILASFGVQAAHAQVDDCSPLFG
CDSLGCDSLSCDSALCCGENCLGEDCLCKSIRQCLADSGITFSNNLTQYYFGTVSGGLEETARYGGHGDYVANLDLGKLG
VHEGLYLKLRAEHRFGQSIGESAGVILPPTLAADLPVADSEGLYLTNVLFTQFLSERFAVYAGKLDTLDGDTNAYASGRG
ITQFSNVAFIANPIVLRSVPYASLGCGFIVMGEEGEPAFNFLVMNPTDTADSDGFDELFADGVAVSAEMRVATDWLGTPG
HQLIGASWSSRDYVSLGQDPRIILPNVPINRASDSWSVYWNTDQALWVDPCDSTRHWGYFARAGIADSDTNPISYLLSAG
LGGASPLRDGDTFGVGYYYSGTSDEIGPLLVGALGPIGDSQGVEVFYRSQLTESISVTPDFQWVDQAREQVADAYLLGLR
MNIAF