TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q7UU92|Q7UU92_RHOBA Putative uncharacterized protein OS=Rhodopirellula baltica (strain SH1) GN=RB3430 PE=4 SV=1
MSNVNPYSSGVDGAAYGNAAIYADETERIGFIRRTYAHLSGAVFAFLALEVVLFTLVPADTMTMLVQRMTGGYGWLLVLG
AFMAVSWMARSWASSGQSRGLQYAGLGLYVVAQAVIMLPLMYIAIRVMNQPQIPILAGIITTLTFAGLTGFVMFTRVDLA
SWGTYLFVAGLVAMGVVVCGVLFGFSLGLFFSAAMVALACGYILYDTSNVLHHYDTRQHVAASLALFASVALLFYYVLRI
LMAFSSSD