TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q7Y175|PUX5_ARATH Plant UBX domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=PUX5 PE=1 SV=1
MATETNENLINSFIEITSSSREEANFFLESHTWNLDAAVSTFLDNDAAAAAEPNPTGPPPPSSTIAGAQSPSQSHSPDYT
PSETSPSPSRSRSASPSSRAAPYGLRSRGGAGENKETENPSGIRSSRSRQHAGNIRTFADLNRSPADGEGSDSDEANEYY
TGGQKSGMMVQDPKKVKDVDELFDQARQSAVDRPVEPSRSASTSFTGAARLLSGEAVSSSPQQQQQEQPQRIMHTITFWL
NGFTVNDGPLRGFSDPENAAFMNSISRSECPSELEPADKKIPVHVDLVRRGENFTEPPKPKNPFQGVGRTLGASGSGSSS
APQASSAPMNVAPAPSRGLVVDPAAPTTSIQLRLADGTRLVSRFNNHHTVRDVRGFIDASRPGGSKEYQLLTMGFPPKQL
TELDQTIEQAGIANAVVIQKF