TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q84L31|RD23C_ARATH Ubiquitin receptor RAD23c OS=Arabidopsis thaliana OX=3702 GN=RAD23C PE=1 SV=2
MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIEENKVAENSFIVIMMNKSKPA
SAAASSASAGTSQAKSIPPSTSQPSISPQTPASVSAPVAPAPTRPPPPAPTPTPAPVAATETVTTPIPEPVPATISSSTP
APDSAPVGSQGDVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTGIPEQAEVPPVAR
PPASAGQPANPPAQTQQPAAAPASGPNANPLDLFPQGLPNVGGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQEL
GKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACN
KNEELAANYLLDHMHEFEE