TCDB is operated by the Saier Lab Bioinformatics Group
>gnl|TC-DB|Q86JM7 1.A.7.2.1 P2X receptor A
MGFSFDWDDIFQYSTVKIVRIRDRRLGILHLSFLVGIVAYIVVYSAIIKKGYLFTEVPIGSVRTSLKGPNTFASNLTYCS
NQQHNGSTYPFTPLECNYWDEQLALFPVGQDSTFTCTTRVRLSKQEANCNFTDPTCKFVDEPGSAKNIYIADIESFTILI
DHTMYASSSGSQFNAVDLHGYILNQDGDEVQIDANGTSIGVSGKPDIMTIGQLLSFGGVSLDQASPVDSNVSIRYDGVVL
FVFITYSNTYTYSTSDFKYVYSVQQIANTIYDVPETIILESIHSRLLYKRHGIRVIFIQTGTIGSFHFQTLLLTLVSGLG
LLAVATTVVDQLAIRLLPQRKSYSSLKFQVTESMSNPMKKRITTDEGEDVLYTRIEGL