TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q86YD3|TMM25_HUMAN Transmembrane protein 25 OS=Homo sapiens OX=9606 GN=TMEM25 PE=1 SV=1
MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLL
SVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPP
ANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRVEVPLLGIVV
AAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQ
MAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL