TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q87WD2|ERIC_PSESM Chloride/fluoride channel protein OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=eriC PE=1 SV=1
MAGQMSKFRRPEQLDLLPYIAKWLALAGLVALLAGSASALFLLSLDHATQWRETHPWVIWLLPVAGFAVGLAYHLIGKPV
DAGNNLIIDEIHDPKKIVPLRMVPMVLIGTVVSHLFGASVGREGTAVQMGGALADQLTHVFRLRREDRRVILMAGISAGF
ASVFGTPLAGALFGLEVLAIGRMRYDALFPCVVAAIVADQVGQAWGVVHTHYVIGEVVPVQLWSVMAVVAAGIVFGLTGL
LFATATHKLGAFVKRLITYSPLRPFAGGLLIAVAVWALGSNHYIDVDKYIGLGIPSIVQSFQMPMAPWDWLGKMVFTVVS
LGTGFKGGEVTPLFYIGATLGNALAPLLHLPFGMLAGIGFVAVFAGAANTPLATIVMAMELFGPEIAPLAAIACIASYLV
SGHTGIYHAQRVGHSKHHRPLPEEIRLSDIKQFHAQSESASERKVTLAGEEK