TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8EAG6|Q8EAG6_SHEON Sodium-type flagellar protein MotX OS=Shewanella oneidensis GN=motX PE=4 SV=1
MLRTALFALLPLVSSMCFAETQAVDIYSQEQLLEMIRSEQYLAKVKQDECQLVQDIEARAEVLKQPLYQFLWGEMLNHGT
CVKANAVKGMALLREAAEQGSPEAMVKLAEYYQTGKFVIRNKDRAVNYLLPAAASGSLAARMMLVRLYGEGYGSPRDYEM
AYNWLYNNVFTDEATKKKALSLLQVLAAKMPASAVARAQQEHLRTR