TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8F191|Q8F191_LEPIN ExbD-related biopolymer transport protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_3245 PE=3 SV=2
MIRIKKKRTLEEISASSMSDIAFLLLVFFMVTAVFFVKEGLNIQLPRKNSNPTLILRENIYEILIAGDLIKMKNKSIGTK
EYRNLIDFRQELNLMEIPDIENKVALIKTTGDTKYGNMLDALSAVQIRGFKQVSVKRLK