TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8GX93|CLCE_ARATH Chloride channel protein CLC-e OS=Arabidopsis thaliana GN=CLC-E PE=2 SV=2
MAATLPLCAALRSPVSSRRFAPIHKTDVPFQFNVVLSPFFGSVAIGGRIFPRLPAAKQETDQDEVGFDQQPSQELAIASA
CLVGVLTGVSVVLFNNCVHLLRDFSWDGIPDRGASWLREAPIGSNWLRVILVPTIGGLVVSILNQLRESAGKSTGDSHSS
LDRVKAVLRPFLKTVAACVTLGTGNSLGPEGPSVEIGASIAKGVNSLFNKSPQTGFSLLAAGSAAGISSGFNAAVAGCFF
AVESVLWPSSSTDSSTSLPNTTSMVILSAVTASVVSEIGLGSEPAFKVPDYDFRSPGELPLYLLLGALCGLVSLALSRCT
SSMTSAVDSLNKDAGIPKAVFPVMGGLSVGIIALVYPEVLYWGFQNVDILLEKRPFVKGLSADLLLQLVAVKIAATAWCR
ASGLVGGYYAPSLFIGGAAGMAYGKFIGLALAQNPDFNLSILEVASPQAYGLVGMAATLAGVCQVPLTAVLLLFELTQDY
RIVLPLLGAVGMSSWITSGQSKRQETRETKETRKRKSQEAVQSLTSSDDESSTNNLCEVESSLCLDDSLNQSEELPKSIF
VSEAMRTRFATVMMSTSLEEALTRMLIEKQSCALIVDPDNIFLGILTLSDIQEFSKARKEGNNRPKDIFVNDICSRSGGK
CKVPWTVTPDMDLLAAQTIMNKHELSHVAVVSGSIDAPRIHPVGVLDRECITLTRRALATRMYLLNSLYL