TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8I132|Q8I132_CAEEL Protein OOC-3, isoform b OS=Caenorhabditis elegans GN=ooc-3 PE=2 SV=1
MKIIWVTLLLLVPQLFATQDIDEEFTHENVWKDPNDPTSGESPPASKRLLSVRNQVQKPDQSLRLILRQLLHETKIDYHL
EGSIKKDVQIKISRHSMSVLSKYLKNDEADLAEEREAVRSALSNIFSVKPPAPDRTWQDTFVTLQPFIFTLNIFILPAAA
FVVLRSIVRPRNFWILVLSTALLVSMYSGYSKKYQEAESRRFAQFQEHAHDSCATEGLLSRMVEILASPFQYRQKSKCLK
YIESQTISIFHEISIIEVFSETISGGFFAFFSGSAKHFNLFFRNLYDGAPLIAQIVMTIFLVLMLGAIRTPFFSYEPIWL
NFCSSSIGKIAGWLDGEPPQQPAPQLLITAKEMKRLEQARNKKPEMISYPTSEREDVVSGSENGNEKKSDNEREESMKME
EDSAPVESSLEDDLSLLGESSEDEDEEKVNESPAKIDSTTLSESSF