TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8IB73|Q8IB73_PLAF7 Oxoglutarate/malate translocator protein, putative OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0031 PE=3 SV=1
MDRDIAKYDLESSSSVDVNKKGNNNKSVFEKIKPFAVGGASGMFATFCIQPLDMVKVRIQLNAEGKNVLRNPFIVAKDII
KNEGFLSLYKGLDAGLTRQVIYTTGRLGLFRTFSDMVKKEGEPLPFYKKCFCALAAGGLGAFIGNPADLSLIRLQADNTL
PKELKRNYTGVFNALYRISKEEGLFALWKGSVPTIARAMSLNLGMLSTYDQSKEFLQKYLGVGMKTNLVASVISGFFAVT
LSLPFDFVKTCMQKMKADPVTKKMPYKNMLDCSIQLYKKGGISIFYSSYATYYVRIAPHAMITLITVDYLNNLLKKIS