TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8IUQ4|SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 OS=Homo sapiens OX=9606 GN=SIAH1 PE=1 SV=2
MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLG
SIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQG
EDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
RSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC