TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8KPZ2|Q8KPZ2_THETH Prepilin-like protein OS=Thermus thermophilus GN=pilA3 PE=4 SV=1
MKRGFTLVEVLVAMAILVVVLAVGVRYFASTSELARNTQARSELQDRVRMVMQVVTADLQMAGARYWNSGNQNQAFSLPL
PPLSGSNMGPKDTLTLYYVTSLRDLASACRRVDYGFEGDTLRRSDVNATPSSGSDCTTPPPNSQPLAEGMLALDIQYQCS
DGSRKDTPDCGTDAYPRSAKVTVAGYSLTSVTNPGPASLTTVTGKTLACPQGRACYALTQEVLMPNLKPLPTP