TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8KPZ3|Q8KPZ3_THETH Prepilin-like protein OS=Thermus thermophilus GN=pilA2 PE=4 SV=1
MRKGLTLVEVLVTLVIMGIAFAALLTSQLANLRASAQARFATDAKAAAVQVLERRSAEVLKSEIVPALSPYKDAPLDPDN
PSGNWRSFYFVDYYFSCPTRVAPSPKQRGGSVANLRPGLTCSGTETIFGIPVAWDIRGENGILGEGVVTVVVTATHPRGP
KVTLGRRVTCYDVYPSPTQDQPAPCPPPGGGRP