TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8KPZ4|Q8KPZ4_THETH Prepilin-like protein OS=Thermus thermophilus GN=pilA1 PE=4 SV=1
MTRRGLTLLELLLVLGILGVLLGLALPLLSPNRLALDQAARSLATQVTRARLEAIRRNAFVGLQVFTEGAGGYLLFVDQN
ANRRYDPGEEFGATHFGQGNWARVRLDPEKSALGNMPLLFDPRGIPAKPITATLVLTSGGATRKVVISQQGRARLE