TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q8LB08|ADT4_ARATH ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2
MALIGKSERFSADFVMGGAAAIVAKSAAAPIERVKLLLQNQGEMIKTGHLIRPYTGLGNCFTRIYREEGVLSFWRGNQAN
VIRYFPTQASNFAFKGYFKNLLGCSKEKDGYLKWFAGNVASGSAAGATTSLFLYHLDYARTRLGTDAKECSVNGKRQFKG
MIDVYRKTLSSDGIKGLYRGFGVSIVGITLYRGMYFGMYDTIKPIVLVGSLEGNFLASFLLGWSITTSAGVIAYPFDTLR
RRMMLTSGQPVKYRNTIHALREILKSEGFYALYRGVTANMLLGVAGAGVLAGYDQLHQIAYKHWVQ