TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8TNK0|Q8TNK0_METAC Large conductance mechanosensitive channel protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_2285 PE=4 SV=1
MGLFSEFKEFLYEYKVIPLAIAFIMGIASTALIKSFVDNIIMPIITPFVPGGGWETATVELGPIVISWGAFLGELVNFII
IAFAVFIIAKKVLQEEKVEKK