TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8VRK4|Q8VRK4_THETH Competence protein DprA OS=Thermus thermophilus GN=dprA PE=4 SV=1
MDPLALALLPGIGPKRLLEVLKAEDPLGFLRERFPEAWRHLPEAEAQAERERRRAEALGVRLLGLWEEGFPEGLKALPQP
PTHLYLKGELPPEREAVALVGTRRASPWALAFARKLARELSEAGLWVVSGLARGIDREAHLGALEAGGRTLGVLGSALDR
VYPPENRPLAQRMDLLSEFPFGTGPKPEFFPRRNRLIAGLCRAVVVVEAPLDSGALITARHALELGKEVLAVPGRPMDER
SLGANRLIQDGAYPVLSAEDVLSYLGMSARPKPLPGLSPEEEALYALLQEKKEALPEALAMALGIPPERVLSLLTLLELK
GLARALPGGRYGPG