TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8VRL1|Q8VRL1_THETH ATP binding motif-containing protein PilF OS=Thermus thermophilus GN=pilF PE=4 SV=1
MQKGLPRAKPLGEILVELGLARPEDVEEALQKQRRGGGRLEDTLVQSGKLRPEALAQAVATQLGYPYVDPEEDPPDPGAP
LLLPEDLCRRYGVFPHRLEGNRLVLLMKDPRNILALDDVRLALKRKGLNYEVAPAVATEAAITKLIERFYGKAELSEIAK
EFAKKQAEEEVPSPLELDESAAQKFVKQVIREAFLQDASDIHIEPRQNDVQVRLRIDGALRPYSTLPKGALNAVISVVKI
MGGLNIAEKRLPQDGRVRYREGAIDVDLRLSTLPTVYGEKAVMRLLKKASDIPEIEDLGFAPGVFERFKEVISKPYGIFL
ITGPTGSGKSFTTFSILKRIATPDKNTQTIEDPVEYEIPGINQTQVNPQAGLTFARALRAFLRQDPDIIMVGEIRDSETA
KIATEAALTGHLVIATLHTNDAAQAITRLDEMGVEPFNISAALIGVLSQRLVRRVCEHCKVEVKPDPETLRRLGLSEAEI
QGARLYKGMGCERCGGTGYKGRYAIHELLVVDDEIRHAIVAGKSATEIKEIARRKGMKTLREDGLYKALQGITTLEEVLA
RTIE