TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8VRL3|Q8VRL3_THETH Competence protein PilC OS=Thermus thermophilus GN=pilC PE=3 SV=1
MRASTPQTVSVGKATKPPPLRVSAALARASWYTLSMPVYQYKARDRQGRLVEATIEAEDLRTAARLLRDRGLFVAEIKEP
GKGLQAEVRIPALERGPGLKDLAIFSRQLATMLGAGLTLLQALAILERQTENRKFREILKQVRTDVEGGMAFSEALSKHK
IFSRLYVNLVRAGETSGGLDLILDRLASFLEKELELRGKIRSAMTYPVIVFVFAVGVAYFLLTGIVPQFAQILTDLGSEL
PLLTRFLIAVSDLLRAATLPLLLLAVALFFAYRWYYGTPQGRRVIDRLKLRLPVFGNLNRKTAVARFSRTLALLLSSGVN
IVEALDITKGTAGNSVVEEIVEAAKLKIQQGDPLNLTLAQHPFVFPPMVSSMVAIGEETGALDTMLSKVADFYEREVDEA
VASLTAAIEPLMIIFLGVIVGMIVAGMFLPLFKIIGTLSVQ